PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold03463-augustus-gene-0.16-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HSF
Protein Properties Length: 461aa    MW: 52774.3 Da    PI: 4.3478
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold03463-augustus-gene-0.16-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind107.21.2e-331252162102
                                                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS
                                   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65 
                                                    Flkk+++++ed+++++++swse+ +sf+v+de+ fa+++Lp+yFkh+nf+SF+RQLn+YgFkk+
  maker-scaffold03463-augustus-gene-0.16-mRNA-1 125 FLKKIFDMVEDPDTNTVVSWSETRDSFIVWDEHVFAEELLPRYFKHKNFSSFIRQLNTYGFKKI 188
                                                    9*************************************************************** PP

                                                    --SSBTTTTXTTSEEEEESXXXXXXXXXXXXXXXXXX CS
                                   HSF_DNA-bind  66 kdeekkskskekiweFkhksFkkgkkellekikrkks 102
                                                    ++           w+F++++F+ gk++ll++ikr+++
  maker-scaffold03463-augustus-gene-0.16-mRNA-1 189 DTYM---------WKFANEEFQSGKRHLLKNIKRRNR 216
                                                    9877.........*********************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.1E-36120214IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004155.8E-50121214IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467854.08E-32121214IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.9E-30125214IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-17125148IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-17163175IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS004340164188IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-17176188IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MATEIDDRYG GGGDDPILSF PEPIEEIETT IKEPVVTVKV EQVEEEEKEQ TTPLHRIPAD  60
SGEVVVPEEL LNDTAPPTLT LAQETEVINF KEEEEEEEDE EEEEDTEFST PKPMEGLHEQ  120
GPPPFLKKIF DMVEDPDTNT VVSWSETRDS FIVWDEHVFA EELLPRYFKH KNFSSFIRQL  180
NTYGFKKIDT YMWKFANEEF QSGKRHLLKN IKRRNRLNKQ EHGVVSLKLR KPGVEIELES  240
LRKDQNVLQV EILKLRQREE DSHNQLAAVE DRIRYAECRQ QKMLLFLTKV SRNPNFAHQL  300
IQKRKLKREL NGGEISKRRR LLATQGHESL LEAIDTSLGV NGRNEVQGDL VTVLTDILQE  360
GVDTFPLQTP FPAPVDDVLC SPLQDQKVNV MPGTSTPPEM SSVYNVMSEK LMEDNSIIDE  420
DFTMNDSQFY SELEDLIAKP PDWGGFVSGL VEPAACIGSM T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5v_D2e-2212321427129Heat shock factor protein 1
5d5v_B2e-2212321427129Heat shock factor protein 1
5d5u_B2e-2212321427129Heat shock factor protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207213LKNIKRR
2302319KRKLKRELNGGEISKRRR
3316320KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP8546001e-138KP854600.1 Quercus variabilis microsatellite Qv560 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889252.11e-136PREDICTED: heat shock factor protein HSF30-like
RefseqXP_015889253.11e-136PREDICTED: heat shock factor protein HSF30-like
TrEMBLB9HDY21e-133B9HDY2_POPTR; Uncharacterized protein
STRINGPOPTR_0006s15050.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106762938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.15e-79heat shock transcription factor A2